PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB08G27600.1
Common NameLOC102700082
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 307aa    MW: 33835.3 Da    PI: 8.0543
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB08G27600.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.26.8e-121661146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g WT+eEde l + v+++G++ W++I ++  + R +k+c++rw +
     OB08G27600.1 16 KGQWTAEEDEVLRRHVREHGPREWSSIEARGLLPRNGKSCRLRWVN 61
                     799************************8876667**********87 PP

2Myb_DNA-binding377.9e-1272112345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++T+eE+   ++  ++ G++ W++I++ +  gRt++++k++w 
     OB08G27600.1  72 KFTQEEERMVIEMQAKVGNK-WALISKQLT-GRTDNDVKNFWS 112
                      79******************.********9.***********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.2131167IPR017930Myb domain
SMARTSM007175.6E-91565IPR001005SANT/Myb domain
SuperFamilySSF466891.2E-2515111IPR009057Homeodomain-like
PfamPF002494.2E-101661IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-181770IPR009057Homeodomain-like
CDDcd001672.34E-111963No hitNo description
PROSITE profilePS5129416.37468119IPR017930Myb domain
SMARTSM007171.5E-1169117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-1771117IPR009057Homeodomain-like
CDDcd001672.17E-972115No hitNo description
PfamPF002491.2E-1072112IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MVAQRRRGGR PAAARKGQWT AEEDEVLRRH VREHGPREWS SIEARGLLPR NGKSCRLRWV  60
NKLQPGLRTG CKFTQEEERM VIEMQAKVGN KWALISKQLT GRTDNDVKNF WSTRKKKLAR  120
MSKAAAPAPP PSRRRSSSSS RALPSTPTES CSLMKDPFQE SSSSYHVGES SHQACTAMEN  180
QLTTDAQSPG RLPAYECSLG LPAPESLTGL PAPESPSWPS SGELALVPAA ECMRNPAPLM  240
LYPAASGDMA SADHSGYGDE LACLQPVLEF QPIQPYGLED DMVFDELSPA TLDFFDQPPP  300
PPPLIKW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-221611827128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006660292.10.0PREDICTED: transcription factor MYB21-like
TrEMBLJ3MUH90.0J3MUH9_ORYBR; Uncharacterized protein
STRINGOB08G27600.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57003357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.11e-46MYB family protein